General Information

  • ID:  hor006825
  • Uniprot ID:  O00585??25-134)
  • Protein name:  C-C motif chemokine 21
  • Gene name:  Lhb
  • Organism:  Homo sapiens
  • Family:  Intercrine beta (chemokine CC) family
  • Source:  Human
  • Expression:  Highly expressed in high endothelial venules of lymph nodes; spleen and appendix. Intermediate levels found in small intestine; thyroid gland and trachea. Low level expression in thymus; bone marrow;
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human)
  • GO MF:  GO:0005576 extracellular region; GO:0005615 extracellular space
  • GO BP:  GO:0008009 chemokine activity; GO:0042379 chemokine receptor binding; GO:0031732 CCR7 chemokine receptor binding; GO:0048020 CCR chemokine receptor binding
  • GO CC:  GO:2000406 positive regulation of T cell migration; GO:0030838 positive regulation of actin filament polymerization; GO:0043123 positive regulation of canonical NF-kappaB signal transduction; GO:0033630 positive regulation of cell adhesion mediated by integrin; GO:0030335 positive regulation of cell migration; GO:2000147 positive regulation of cell motility; GO:0001954 positive regulation of cell-matrix adhesion; GO:0050921 positive regulation of chemotaxis; GO:0002606 positive regulation of dendritic cell antigen processing and presentation; GO:1903237 negative regulation of leukocyte tethering or rolling; GO:0070374 positive regulation of ERK1 and ERK2 cascade; GO:0051491 positive regulation of filopodium assembly; GO:0010560 positive regulation of glycoprotein biosynthetic process; GO:0046330 positive regulation of JNK cascade; GO:2000529 positive regulation of myeloid dendritic cell chemotaxis; GO:0090023 positive regulation of neutrophil chemotaxis; GO:0051897 positive regulation

Sequence Information

  • Sequence:  DGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP
  • Length:  110
  • Propeptide:  MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP
  • Signal peptide:  MAQSLALSLLILVLAFGIPRTQG
  • Modification:  T1 N-acetylalanine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA